![]() | Class c: Alpha and beta proteins (a/b) [51349] (107 folds) |
![]() | Fold c.23: Flavodoxin-like [52171] (17 superfamilies) |
![]() | Superfamily c.23.5: Flavoproteins [52218] (3 families) ![]() |
![]() | Family c.23.5.1: Flavodoxin-related [52219] (3 proteins) |
![]() | Protein Rubredoxin oxygen:oxidoreductase (ROO), C-terminal domain [52229] (1 species) |
![]() | Species Desulfovibrio gigas [TaxId:879] [52230] (1 PDB entry) |
![]() | Domain d1e5db1: 1e5d B:251-402 [31209] Other proteins in same PDB: d1e5da2, d1e5db2 |
PDB Entry: 1e5d (more details), 2.5 Å
SCOP Domain Sequences for d1e5db1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1e5db1 c.23.5.1 (B:251-402) Rubredoxin oxygen:oxidoreductase (ROO), C-terminal domain {Desulfovibrio gigas} ptnkvvifydsmwhstekmarvlaesfrdegctvklmwckachhsqimseisdagavivg spthnngilpyvagtlqyikglrpqnkiggafgsfgwsgestkvlaewltgmgfdmpatp vkvknvpthadyeqlktmaqtiaralkaklaa
Timeline for d1e5db1: