Lineage for d4yaob1 (4yao B:67-235)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2114715Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 2115525Superfamily c.23.5: Flavoproteins [52218] (9 families) (S)
  5. 2116045Family c.23.5.0: automated matches [191330] (1 protein)
    not a true family
  6. 2116046Protein automated matches [190158] (24 species)
    not a true protein
  7. 2116138Species Norway rat (Rattus norvegicus) [TaxId:10116] [255999] (10 PDB entries)
  8. 2116156Domain d4yaob1: 4yao B:67-235 [312089]
    Other proteins in same PDB: d4yaoa2, d4yaoa3, d4yaob2, d4yaob3
    automated match to d1ja1a2
    complexed with 2am, fad, fmn, po4; mutant

Details for d4yaob1

PDB Entry: 4yao (more details), 2.5 Å

PDB Description: reduced cypor mutant - g143del
PDB Compounds: (B:) NADPH--cytochrome P450 reductase

SCOPe Domain Sequences for d4yaob1:

Sequence, based on SEQRES records: (download)

>d4yaob1 c.23.5.0 (B:67-235) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]}
ssfvekmkktgrniivfygsqtgtaeefanrlskdahrygmrgmsadpeeydladlsslp
eidkslvvfcmatygedptdnaqdfydwlqetdvdltgvkfavfglgnktyehfnamgky
vdqrleqlgaqrifelglgdddgnleedfitwreqfwpavceffgvea

Sequence, based on observed residues (ATOM records): (download)

>d4yaob1 c.23.5.0 (B:67-235) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]}
ssfvekmkktgrniivfygsqtgtaeefanrlskdahrygmrgmsadpeeydladlsslp
eidkslvvfcmattdnaqdfydwlqetdvdltgvkfavfglgnktyehfnamgkyvdqrl
eqlgaqrifelglgdddgnleedfitwreqfwpavceffgvea

SCOPe Domain Coordinates for d4yaob1:

Click to download the PDB-style file with coordinates for d4yaob1.
(The format of our PDB-style files is described here.)

Timeline for d4yaob1: