SCOPe 2.08: Domain d4yhyc1: 4yhy C:4-109

Lineage for d4yhyc1 (4yhy C:4-109)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (31 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187920] (1793 PDB entries)

8. Domain d4yhyc1: 4yhy C:4-109 [312082]
   Other proteins in same PDB: d4yhyb_, d4yhyc2, d4yhyh_, d4yhyl2
   automated match to d1ad0a1
   complexed with m3l

Details for d4yhyc1

PDB Entry: 4yhy, 1.9 Å

PDB Description: crystal structure of 309m3-b in complex with trimethylated lys

PDB Compounds: (C:) Fab light chain

SCOPe Domain Sequences for d4yhyc1:

Sequence; same for both SEQRES and ATOM records:

>d4yhyc1 b.1.1.0 (C:4-109) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ltqppsvsvapgqtaritcggtnigdisvhwyqqrpgqaplvvvyddsdrpsgiperfsg
snsgntatltisrveagdeadyycqvwddsinayvfgtgtkvtvlr

Timeline for d4yhyc1:

• d4yhyc1 first appeared in SCOPe 2.06
  
• d4yhyc1 appears in SCOPe 2.07