Lineage for d1e5da1 (1e5d A:251-402)

  1. Root: SCOP 1.75
  2. 814173Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 825505Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 825904Superfamily c.23.5: Flavoproteins [52218] (8 families) (S)
  5. 825905Family c.23.5.1: Flavodoxin-related [52219] (5 proteins)
    binds FMN
  6. 826010Protein Rubredoxin oxygen:oxidoreductase (ROO), C-terminal domain [52229] (1 species)
  7. 826011Species Desulfovibrio gigas [TaxId:879] [52230] (1 PDB entry)
  8. 826012Domain d1e5da1: 1e5d A:251-402 [31208]
    Other proteins in same PDB: d1e5da2, d1e5db2

Details for d1e5da1

PDB Entry: 1e5d (more details), 2.5 Å

PDB Description: rubredoxin oxygen:oxidoreductase (roo) from anaerobe desulfovibrio gigas
PDB Compounds: (A:) rubredoxin:oxygen oxidoreductase

SCOP Domain Sequences for d1e5da1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1e5da1 c.23.5.1 (A:251-402) Rubredoxin oxygen:oxidoreductase (ROO), C-terminal domain {Desulfovibrio gigas [TaxId: 879]}
ptnkvvifydsmwhstekmarvlaesfrdegctvklmwckachhsqimseisdagavivg
spthnngilpyvagtlqyikglrpqnkiggafgsfgwsgestkvlaewltgmgfdmpatp
vkvknvpthadyeqlktmaqtiaralkaklaa

SCOP Domain Coordinates for d1e5da1:

Click to download the PDB-style file with coordinates for d1e5da1.
(The format of our PDB-style files is described here.)

Timeline for d1e5da1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1e5da2