SCOPe 2.06: Domain d4yp9b1: 4yp9 B:24-364

Lineage for d4yp9b1 (4yp9 B:24-364)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.93: Periplasmic binding protein-like I [53821] (1 superfamily)
   consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
   parallel beta-sheet of 6 strands, order 213456

4. Superfamily c.93.1: Periplasmic binding protein-like I [53822] (2 families)
   Similar in architecture to the superfamily II but partly differs in topology

5. Family c.93.1.1: L-arabinose binding protein-like [53823] (18 proteins)

6. Protein Quorum-sensing signal (autoinducer-2) binding protein LuxP [69622] (1 species)

7. Species Vibrio harveyi [TaxId:669] [69623] (6 PDB entries)

8. Domain d4yp9b1: 4yp9 B:24-364 [312076]
   Other proteins in same PDB: d4yp9a2, d4yp9b2
   automated match to d1zhha_
   complexed with 4ex, ca, mg

Details for d4yp9b1

PDB Entry: 4yp9, 2.7 Å

PDB Description: crystal structure of luxp in complex with a formose derived ai-2 analogue

PDB Compounds: (B:) Autoinducer 2-binding periplasmic protein luxP

SCOPe Domain Sequences for d4yp9b1:

Sequence; same for both SEQRES and ATOM records:

>d4yp9b1 c.93.1.1 (B:24-364) Quorum-sensing signal (autoinducer-2) binding protein LuxP {Vibrio harveyi [TaxId: 669]}
vlngywgyqefldefpeqrnltnalseavraqpvplskptqrpikisvvypgqqvsdywv
rniasfekrlyklninyqlnqvftrpnadikqqslslmealksksdyliftldttrhrkf
vehvldstntklilqnittpvrewdkhqpflyvgfdhaegsrelatefgkffpkhtyysv
lyfsegyisdvrgdtfihqvnrdnnfelqsayytkatkqsgydaakaslakhpdvdfiya
cstdvalgavdalaelgredimingwgggsaeldaiqkgdlditvmrmnddtgiamaeai
kwdledkpvptvysgdfeivtkadsperiealkkrafrysd

Timeline for d4yp9b1:

• d4yp9b1 is new in SCOPe 2.06-stable
  
• d4yp9b1 appears in SCOPe 2.07
  
• d4yp9b1 appears in the current release, SCOPe 2.08