Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.93: Periplasmic binding protein-like I [53821] (1 superfamily) consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication parallel beta-sheet of 6 strands, order 213456 |
Superfamily c.93.1: Periplasmic binding protein-like I [53822] (2 families) Similar in architecture to the superfamily II but partly differs in topology |
Family c.93.1.1: L-arabinose binding protein-like [53823] (18 proteins) |
Protein Quorum-sensing signal (autoinducer-2) binding protein LuxP [69622] (1 species) |
Species Vibrio harveyi [TaxId:669] [69623] (6 PDB entries) |
Domain d4yp9b1: 4yp9 B:24-364 [312076] Other proteins in same PDB: d4yp9a2, d4yp9b2 automated match to d1zhha_ complexed with 4ex, ca, mg |
PDB Entry: 4yp9 (more details), 2.7 Å
SCOPe Domain Sequences for d4yp9b1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4yp9b1 c.93.1.1 (B:24-364) Quorum-sensing signal (autoinducer-2) binding protein LuxP {Vibrio harveyi [TaxId: 669]} vlngywgyqefldefpeqrnltnalseavraqpvplskptqrpikisvvypgqqvsdywv rniasfekrlyklninyqlnqvftrpnadikqqslslmealksksdyliftldttrhrkf vehvldstntklilqnittpvrewdkhqpflyvgfdhaegsrelatefgkffpkhtyysv lyfsegyisdvrgdtfihqvnrdnnfelqsayytkatkqsgydaakaslakhpdvdfiya cstdvalgavdalaelgredimingwgggsaeldaiqkgdlditvmrmnddtgiamaeai kwdledkpvptvysgdfeivtkadsperiealkkrafrysd
Timeline for d4yp9b1: