![]() | Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
![]() | Fold c.23: Flavodoxin-like [52171] (15 superfamilies) 3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345 |
![]() | Superfamily c.23.5: Flavoproteins [52218] (8 families) ![]() |
![]() | Family c.23.5.1: Flavodoxin-related [52219] (5 proteins) binds FMN |
![]() | Protein FMN-binding domain of the cytochrome P450bm-3 [52227] (1 species) |
![]() | Species Bacillus megaterium [TaxId:1404] [52228] (1 PDB entry) |
![]() | Domain d1bvyf_: 1bvy F: [31207] Other proteins in same PDB: d1bvya_, d1bvyb_ complexed with eth, fmn, hem |
PDB Entry: 1bvy (more details), 2.03 Å
SCOP Domain Sequences for d1bvyf_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1bvyf_ c.23.5.1 (F:) FMN-binding domain of the cytochrome P450bm-3 {Bacillus megaterium [TaxId: 1404]} ntpllvlygsnmgtaegtardladiamskgfapqvatldshagnlpregavlivtasyng hppdnakqfvdwldqasadevkgvrysvfgcgdknwattyqkvpafidetlaakgaenia drgeadasddfegtyeewrehmwsdvaayfnl
Timeline for d1bvyf_: