SCOP 1.61: Domain d1bvyf_: 1bvy F:

Lineage for d1bvyf_ (1bvy F:)

1. Root: SCOP 1.61

2. Class c: Alpha and beta proteins (a/b) [51349] (117 folds)

3. Fold c.23: Flavodoxin-like [52171] (16 superfamilies)

4. Superfamily c.23.5: Flavoproteins [52218] (3 families)

5. Family c.23.5.1: Flavodoxin-related [52219] (3 proteins)

6. Protein FMN-binding domain of the cytochrome P450bm-3 [52227] (1 species)

7. Species Bacillus megaterium [TaxId:1404] [52228] (1 PDB entry)

8. Domain d1bvyf_: 1bvy F: [31207]
   Other proteins in same PDB: d1bvya_, d1bvyb_

Details for d1bvyf_

PDB Entry: 1bvy, 2.03 Å

PDB Description: complex of the heme and fmn-binding domains of the cytochrome p450(bm-3)

SCOP Domain Sequences for d1bvyf_:

Sequence; same for both SEQRES and ATOM records:

>d1bvyf_ c.23.5.1 (F:) FMN-binding domain of the cytochrome P450bm-3 {Bacillus megaterium}
ntpllvlygsnmgtaegtardladiamskgfapqvatldshagnlpregavlivtasyng
hppdnakqfvdwldqasadevkgvrysvfgcgdknwattyqkvpafidetlaakgaenia
drgeadasddfegtyeewrehmwsdvaayfnl

Timeline for d1bvyf_:

• d1bvyf_ first appeared (with stable ids) in SCOP 1.55
  
• d1bvyf_ appears in SCOP 1.59
  
• d1bvyf_ appears in SCOP 1.63
  
• d1bvyf_ appears in the current release, SCOPe 2.08