| Class b: All beta proteins [48724] (180 folds) |
| Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily) sandwich; 12-14 strands in 2 sheets; complex topology |
Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (27 families) ![]() |
| Family b.29.1.13: Lectin leg-like [74904] (4 proteins) mammalian protein related to legume lectins automatically mapped to Pfam PF03388 |
| Protein automated matches [190462] (2 species) not a true protein |
| Species Human (Homo sapiens) [TaxId:9606] [197238] (11 PDB entries) |
| Domain d4ygdg_: 4ygd G: [312067] automated match to d4gkya_ complexed with ca, cl |
PDB Entry: 4ygd (more details), 2.51 Å
SCOPe Domain Sequences for d4ygdg_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4ygdg_ b.29.1.13 (G:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
phrrfeykysfkgphlvqsdgtvpfwahagnaipssdqirvapslksqrgsvwtktkaaf
enwevevtfrvtgrgrigadglaiwyaenqglegpvfgsadlwngvgiffdsfdndgkkn
npaiviignngqihydhqndgasqalascqrdfrnkpypvrakityyqntltvminngft
pdkndyefcakvenmiipaqghfgisaatggladdhdvlsfltfqlt
Timeline for d4ygdg_: