Lineage for d4ygdc_ (4ygd C:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2778274Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 2778275Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (27 families) (S)
  5. 2780347Family b.29.1.13: Lectin leg-like [74904] (4 proteins)
    mammalian protein related to legume lectins
    automatically mapped to Pfam PF03388
  6. 2780369Protein automated matches [190462] (2 species)
    not a true protein
  7. 2780375Species Human (Homo sapiens) [TaxId:9606] [197238] (11 PDB entries)
  8. 2780395Domain d4ygdc_: 4ygd C: [312064]
    automated match to d4gkya_
    complexed with ca, cl

Details for d4ygdc_

PDB Entry: 4ygd (more details), 2.51 Å

PDB Description: crystal structure of ergic-53/mcfd2, monoclinic calcium-bound form 2
PDB Compounds: (C:) Protein ERGIC-53

SCOPe Domain Sequences for d4ygdc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4ygdc_ b.29.1.13 (C:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
phrrfeykysfkgphlvqsdgtvpfwahagnaipssdqirvapslksqrgsvwtktkaaf
enwevevtfrvtgrgrigadglaiwyaenqglegpvfgsadlwngvgiffdsfdndgkkn
npaiviignngqihydhqndgasqalascqrdfrnkpypvrakityyqntltvminngft
pdkndyefcakvenmiipaqghfgisaatggladdhdvlsfltfqlt

SCOPe Domain Coordinates for d4ygdc_:

Click to download the PDB-style file with coordinates for d4ygdc_.
(The format of our PDB-style files is described here.)

Timeline for d4ygdc_: