Class b: All beta proteins [48724] (180 folds) |
Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily) sandwich; 12-14 strands in 2 sheets; complex topology |
Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (27 families) |
Family b.29.1.13: Lectin leg-like [74904] (4 proteins) mammalian protein related to legume lectins automatically mapped to Pfam PF03388 |
Protein automated matches [190462] (2 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [197238] (11 PDB entries) |
Domain d4ygdc_: 4ygd C: [312064] automated match to d4gkya_ complexed with ca, cl |
PDB Entry: 4ygd (more details), 2.51 Å
SCOPe Domain Sequences for d4ygdc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4ygdc_ b.29.1.13 (C:) automated matches {Human (Homo sapiens) [TaxId: 9606]} phrrfeykysfkgphlvqsdgtvpfwahagnaipssdqirvapslksqrgsvwtktkaaf enwevevtfrvtgrgrigadglaiwyaenqglegpvfgsadlwngvgiffdsfdndgkkn npaiviignngqihydhqndgasqalascqrdfrnkpypvrakityyqntltvminngft pdkndyefcakvenmiipaqghfgisaatggladdhdvlsfltfqlt
Timeline for d4ygdc_: