Lineage for d4ykza_ (4ykz A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2973214Fold d.122: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55873] (1 superfamily)
    8-stranded mixed beta-sheet; 2 layers: alpha/beta
  4. 2973215Superfamily d.122.1: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55874] (5 families) (S)
  5. 2973216Family d.122.1.1: Heat shock protein 90, HSP90, N-terminal domain [55875] (2 proteins)
  6. 2973217Protein HSP90 [55876] (3 species)
  7. 2973319Species Human (Homo sapiens) [TaxId:9606] [55878] (189 PDB entries)
    Uniprot P08238 10-220 # HSP 90-beta isoform ! Uniprot P07900 16-223
  8. 2973466Domain d4ykza_: 4ykz A: [312063]
    automated match to d2xjxa_
    complexed with 4ev

Details for d4ykza_

PDB Entry: 4ykz (more details), 1.85 Å

PDB Description: heat shock protein 90 bound to cs320
PDB Compounds: (A:) Heat shock protein HSP 90-alpha

SCOPe Domain Sequences for d4ykza_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4ykza_ d.122.1.1 (A:) HSP90 {Human (Homo sapiens) [TaxId: 9606]}
evetfafqaeiaqlmsliintfysnkeiflrelisnssdaldkiryesltdpskldsgke
lhinlipnkqdrtltivdtgigmtkadlinnlgtiaksgtkafmealqagadismigqfg
vgfysaylvaekvtvitkhnddeqyawessaggsftvrtdtgepmgrgtkvilhlkedqt
eyleerrikeivkkhsqfigypitlfve

SCOPe Domain Coordinates for d4ykza_:

Click to download the PDB-style file with coordinates for d4ykza_.
(The format of our PDB-style files is described here.)

Timeline for d4ykza_: