SCOPe 2.08: Domain d4yc1b1: 4yc1 B:1-145

Lineage for d4yc1b1 (4yc1 B:1-145)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.20: UBC-like [54494] (1 superfamily)
   alpha-beta(4)-alpha(3); core: meander beta-sheet plus one helix 2

4. Superfamily d.20.1: UBC-like [54495] (5 families)

5. Family d.20.1.2: UEV domain [75383] (3 proteins)

6. Protein Tumor susceptibility gene 101 (TSG101) [75384] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [75385] (14 PDB entries)

8. Domain d4yc1b1: 4yc1 B:1-145 [312059]
   Other proteins in same PDB: d4yc1a2, d4yc1b2
   automated match to d1m4qa_
   complexed with so4

Details for d4yc1b1

PDB Entry: 4yc1, 2 Å

PDB Description: structure of the human tsg101-uev domain in the p321 space group

PDB Compounds: (B:) Tumor susceptibility gene 101 protein

SCOPe Domain Sequences for d4yc1b1:

Sequence; same for both SEQRES and ATOM records:

>d4yc1b1 d.20.1.2 (B:1-145) Tumor susceptibility gene 101 (TSG101) {Human (Homo sapiens) [TaxId: 9606]}
mavsesqlkkmvskykyrdltvretvnvitlykdlkpvldsyvfndgssrelmnltgtip
vpyrgntynipiclwlldtypynppicfvkptssmtiktgkhvdangkiylpylhewkhp
qsdllgliqvmivvfgdeppvfsrp

Timeline for d4yc1b1:

• d4yc1b1 first appeared in SCOPe 2.06
  
• d4yc1b1 appears in SCOPe 2.07