Lineage for d4yb7j2 (4yb7 J:225-299)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2192663Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2193923Superfamily d.58.5: GlnB-like [54913] (6 families) (S)
    form timeric structures with the orthogonally packed beta-sheets
  5. 2194218Family d.58.5.0: automated matches [191474] (1 protein)
    not a true family
  6. 2194219Protein automated matches [190753] (16 species)
    not a true protein
  7. 2194266Species Campylobacter jejuni [TaxId:195099] [311910] (3 PDB entries)
  8. 2194282Domain d4yb7j2: 4yb7 J:225-299 [312058]
    Other proteins in same PDB: d4yb7a1, d4yb7b1, d4yb7c1, d4yb7d1, d4yb7e1, d4yb7f1, d4yb7g1, d4yb7h1, d4yb7i1, d4yb7j1, d4yb7k1, d4yb7l1
    automated match to d1h3da2
    complexed with acy, atp, mg, po4

Details for d4yb7j2

PDB Entry: 4yb7 (more details), 2.2 Å

PDB Description: adenosine triphosphate phosphoribosyltransferase from campylobacter jejuni in complex with atp
PDB Compounds: (J:) ATP phosphoribosyltransferase

SCOPe Domain Sequences for d4yb7j2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4yb7j2 d.58.5.0 (J:225-299) automated matches {Campylobacter jejuni [TaxId: 195099]}
eskyimlhapkekldkiqallpgverptilplahdeknvalhmvskenlfwetmealkee
gassilvlpiekmlk

SCOPe Domain Coordinates for d4yb7j2:

Click to download the PDB-style file with coordinates for d4yb7j2.
(The format of our PDB-style files is described here.)

Timeline for d4yb7j2: