Lineage for d4yh2d2 (4yh2 D:88-221)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2712830Fold a.45: GST C-terminal domain-like [47615] (1 superfamily)
    core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix
  4. 2712831Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families) (S)
    this domains follows the thioredoxin-like N-terminal domain
  5. 2713795Family a.45.1.0: automated matches [227130] (1 protein)
    not a true family
  6. 2713796Protein automated matches [226831] (73 species)
    not a true protein
  7. 2713957Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [225709] (17 PDB entries)
  8. 2713985Domain d4yh2d2: 4yh2 D:88-221 [312053]
    Other proteins in same PDB: d4yh2a1, d4yh2b1, d4yh2c1, d4yh2d1
    automated match to d4pnfa2
    complexed with gsh

Details for d4yh2d2

PDB Entry: 4yh2 (more details), 1.72 Å

PDB Description: glutathione transferase e6 from drosophila melanogaster
PDB Compounds: (D:) Glutathione S transferase E6

SCOPe Domain Sequences for d4yh2d2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4yh2d2 a.45.1.0 (D:88-221) automated matches {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
kdplkravvdqrlhfesgvvfangirsisksvlfqgqtkvpkerydaiieiydfvetflk
gqdyiagnqltiadfslvssvasleafvaldttkyprigawikkleqlpyyeeangkgvr
qlvaifkktnftfe

SCOPe Domain Coordinates for d4yh2d2:

Click to download the PDB-style file with coordinates for d4yh2d2.
(The format of our PDB-style files is described here.)

Timeline for d4yh2d2: