Lineage for d4yh2d1 (4yh2 D:1-87)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2876126Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 2876127Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 2878967Family c.47.1.0: automated matches [191312] (1 protein)
    not a true family
  6. 2878968Protein automated matches [190056] (195 species)
    not a true protein
  7. 2879500Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [225708] (18 PDB entries)
  8. 2879532Domain d4yh2d1: 4yh2 D:1-87 [312052]
    Other proteins in same PDB: d4yh2a2, d4yh2b2, d4yh2c2, d4yh2d2
    automated match to d4pnfa1
    complexed with gsh

Details for d4yh2d1

PDB Entry: 4yh2 (more details), 1.72 Å

PDB Description: glutathione transferase e6 from drosophila melanogaster
PDB Compounds: (D:) Glutathione S transferase E6

SCOPe Domain Sequences for d4yh2d1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4yh2d1 c.47.1.0 (D:1-87) automated matches {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
mvkltlygldpsppvravkltlaalnltyeyvnvdivaraqlspeyleknpqhtvptled
dghyiwdshaiiaylvskyadsdalyp

SCOPe Domain Coordinates for d4yh2d1:

Click to download the PDB-style file with coordinates for d4yh2d1.
(The format of our PDB-style files is described here.)

Timeline for d4yh2d1: