| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.47: Thioredoxin fold [52832] (2 superfamilies) core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest |
Superfamily c.47.1: Thioredoxin-like [52833] (24 families) ![]() |
| Family c.47.1.0: automated matches [191312] (1 protein) not a true family |
| Protein automated matches [190056] (195 species) not a true protein |
| Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [225708] (18 PDB entries) |
| Domain d4yh2d1: 4yh2 D:1-87 [312052] Other proteins in same PDB: d4yh2a2, d4yh2b2, d4yh2c2, d4yh2d2 automated match to d4pnfa1 complexed with gsh |
PDB Entry: 4yh2 (more details), 1.72 Å
SCOPe Domain Sequences for d4yh2d1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4yh2d1 c.47.1.0 (D:1-87) automated matches {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
mvkltlygldpsppvravkltlaalnltyeyvnvdivaraqlspeyleknpqhtvptled
dghyiwdshaiiaylvskyadsdalyp
Timeline for d4yh2d1: