SCOP 1.73: Domain d1flaa_: 1fla A:

Lineage for d1flaa_ (1fla A:)

1. Root: SCOP 1.73

2. Class c: Alpha and beta proteins (a/b) [51349] (141 folds)

3. Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
   3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345

4. Superfamily c.23.5: Flavoproteins [52218] (8 families)

5. Family c.23.5.1: Flavodoxin-related [52219] (5 proteins)
   binds FMN

6. Protein Flavodoxin [52220] (9 species)

7. Species Clostridium beijerinckii [TaxId:1520] [52226] (16 PDB entries)

8. Domain d1flaa_: 1fla A: [31205]
   complexed with fmn; mutant

Details for d1flaa_

PDB Entry: 1fla, 1.9 Å

PDB Description: clostridium beijerinckii flavodoxin mutant: g57d reduced

PDB Compounds: (A:) flavodoxin

SCOP Domain Sequences for d1flaa_:

Sequence; same for both SEQRES and ATOM records:

>d1flaa_ c.23.5.1 (A:) Flavodoxin {Clostridium beijerinckii [TaxId: 1520]}
mkivywsgtgntekmaeliakgiiesgkdvntinvsdvnidellnedililgcsamddev
leesefepfieeistkisgkkvalfgsygwgdgkwmrdfeermngygcvvvetplivqne
pdeaeqdciefgkkiani

Timeline for d1flaa_:

• d1flaa_ first appeared (with stable ids) in SCOP 1.55, called d1fla__
  
• d1flaa_ was called d1fla__ in SCOP 1.71
  
• d1flaa_ appears in SCOP 1.75
  
• d1flaa_ appears in the current release, SCOPe 2.08