| Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
| Fold c.23: Flavodoxin-like [52171] (15 superfamilies) 3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345 |
Superfamily c.23.5: Flavoproteins [52218] (9 families) ![]() |
| Family c.23.5.1: Flavodoxin-related [52219] (6 proteins) binds FMN |
| Protein Flavodoxin [52220] (9 species) |
| Species Clostridium beijerinckii [TaxId:1520] [52226] (16 PDB entries) |
| Domain d1fvxa_: 1fvx A: [31204] complexed with fmn; mutant |
PDB Entry: 1fvx (more details), 1.9 Å
SCOPe Domain Sequences for d1fvxa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1fvxa_ c.23.5.1 (A:) Flavodoxin {Clostridium beijerinckii [TaxId: 1520]}
mkivywsgtgntekmaeliakgiiesgkdvntinvsdvnidellnedililgcsamndev
leesefepfieeistkisgkkvalfgsygwgdgkwmrdfeermngygcvvvetplivqne
pdeaeqdciefgkkiani
Timeline for d1fvxa_: