Lineage for d1fvx__ (1fvx -)
- Root: SCOP 1.57
Class c: Alpha and beta proteins (a/b) [51349] (107 folds) 
Fold c.23: Flavodoxin-like [52171] (17 superfamilies) 
Superfamily c.23.5: Flavoproteins [52218] (3 families) 
Family c.23.5.1: Flavodoxin-related [52219] (3 proteins) Protein Flavodoxin [52220] (6 species) 
Species Clostridium beijerinckii [52226] (16 PDB entries) 
Domain d1fvx__: 1fvx - [31204]
Details for d1fvx__
PDB Entry: 1fvx (more details), 1.9 Å
PDB Description: clostridium beijerinckii flavodoxin mutant: g57n oxidized
SCOP Domain Sequences for d1fvx__:
Sequence; same for both SEQRES and ATOM records: (download)
>d1fvx__ c.23.5.1 (-) Flavodoxin {Clostridium beijerinckii}
mkivywsgtgntekmaeliakgiiesgkdvntinvsdvnidellnedililgcsamndev
leesefepfieeistkisgkkvalfgsygwgdgkwmrdfeermngygcvvvetplivqne
pdeaeqdciefgkkiani
SCOP Domain Coordinates for d1fvx__:
Click to download the PDB-style file with coordinates for d1fvx__.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1fvx__:
- d1fvx__ first appeared (with stable ids) in SCOP 1.55
- d1fvx__ appears in SCOP 1.59
- d1fvx__ appears in the current release, SCOPe 2.08, called d1fvxa_
View in 3D