Lineage for d4yjmd_ (4yjm D:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2946590Fold d.45: ClpS-like [54735] (1 superfamily)
    beta-alpha(2)-beta-alpha-beta; 2 layers, alpha/beta
  4. 2946591Superfamily d.45.1: ClpS-like [54736] (3 families) (S)
  5. 2946656Family d.45.1.0: automated matches [191583] (1 protein)
    not a true family
  6. 2946657Protein automated matches [191039] (4 species)
    not a true protein
  7. 2946667Species Agrobacterium tumefaciens [TaxId:176299] [312034] (1 PDB entry)
  8. 2946671Domain d4yjmd_: 4yjm D: [312035]
    automated match to d3gq1a_

Details for d4yjmd_

PDB Entry: 4yjm (more details), 1.95 Å

PDB Description: the apo structure of agrobacterium tumefaciens clps2
PDB Compounds: (D:) ATP-dependent Clp protease adapter protein ClpS 2

SCOPe Domain Sequences for d4yjmd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4yjmd_ d.45.1.0 (D:) automated matches {Agrobacterium tumefaciens [TaxId: 176299]}
erpklykvmllnddytprefvtvvlkavfrmsedtgrrvmmtahrfgsavvvvcerdiae
tkakeatdlgkeagfplmfttepe

SCOPe Domain Coordinates for d4yjmd_:

Click to download the PDB-style file with coordinates for d4yjmd_.
(The format of our PDB-style files is described here.)

Timeline for d4yjmd_: