![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily) consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest |
![]() | Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) ![]() Similar in architecture to the superfamily I but partly differs in topology |
![]() | Family c.94.1.0: automated matches [191309] (1 protein) not a true family |
![]() | Protein automated matches [190039] (161 species) not a true protein |
![]() | Species Campylobacter jejuni [TaxId:195099] [311908] (7 PDB entries) |
![]() | Domain d4yb5d1: 4yb5 D:5-224 [312032] Other proteins in same PDB: d4yb5a2, d4yb5b2, d4yb5c2, d4yb5d2, d4yb5e2, d4yb5f2 automated match to d1h3da1 complexed with his, k, peg, pge, scn |
PDB Entry: 4yb5 (more details), 2.24 Å
SCOPe Domain Sequences for d4yb5d1:
Sequence, based on SEQRES records: (download)
>d4yb5d1 c.94.1.0 (D:5-224) automated matches {Campylobacter jejuni [TaxId: 195099]} trlriaiqksgrlskesiellsecgvkmhiheqsliafstnlpidilrvrdddipglifd gvvdlgiigenvleenelerqslgenpsykllkkldfgycrlslalpqenkfqnlkdfeg lriatsypqllkrfmkenginyknctltgsvevapranladaicdlvssgatlqannlke vkviyesracliqkenalskekqalvdkimlrvagvmqar
>d4yb5d1 c.94.1.0 (D:5-224) automated matches {Campylobacter jejuni [TaxId: 195099]} trlriaiqksgrlskesiellsecgvkmhiheqsliafstnlpidilrvrdddipglifd gvvdlgiigenvleenelerqslgenpsykllkkldfgycrlslalpqeqnlkdfeglri atsypqllkrfmkenginyknctltgsvevapranladaicdlvssgatlqannlkevkv iyesracliqkenalskekqalvdkimlrvagvmqar
Timeline for d4yb5d1: