SCOPe 2.08: Domain d4yh2a2: 4yh2 A:88-222

Lineage for d4yh2a2 (4yh2 A:88-222)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.45: GST C-terminal domain-like [47615] (1 superfamily)
   core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix

4. Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families)
   this domains follows the thioredoxin-like N-terminal domain

5. Family a.45.1.0: automated matches [227130] (1 protein)
   not a true family

6. Protein automated matches [226831] (73 species)
   not a true protein

7. Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [225709] (17 PDB entries)

8. Domain d4yh2a2: 4yh2 A:88-222 [312030]
   Other proteins in same PDB: d4yh2a1, d4yh2b1, d4yh2c1, d4yh2d1
   automated match to d4pnfa2
   complexed with gsh

Details for d4yh2a2

PDB Entry: 4yh2, 1.72 Å

PDB Description: glutathione transferase e6 from drosophila melanogaster

PDB Compounds: (A:) Glutathione S transferase E6

SCOPe Domain Sequences for d4yh2a2:

Sequence; same for both SEQRES and ATOM records:

>d4yh2a2 a.45.1.0 (A:88-222) automated matches {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
kdplkravvdqrlhfesgvvfangirsisksvlfqgqtkvpkerydaiieiydfvetflk
gqdyiagnqltiadfslvssvasleafvaldttkyprigawikkleqlpyyeeangkgvr
qlvaifkktnftfea

Timeline for d4yh2a2:

• d4yh2a2 first appeared in SCOPe 2.06
  
• d4yh2a2 appears in SCOPe 2.07