Lineage for d4xcnf1 (4xcn F:1-106)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2739519Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 2742100Protein automated matches [190119] (24 species)
    not a true protein
  7. 2742214Species Human (Homo sapiens) [TaxId:9606] [188740] (709 PDB entries)
  8. 2743500Domain d4xcnf1: 4xcn F:1-106 [312027]
    Other proteins in same PDB: d4xcnb2, d4xcnd2, d4xcnf2, d4xcni2, d4xcnk2, d4xcnl2
    automated match to d1dn0a1
    complexed with 44e, gol, po4, unl

Details for d4xcnf1

PDB Entry: 4xcn (more details), 2.9 Å

PDB Description: crystal structure of human 4e10 fab in complex with phosphatidic acid (06:0 pa); 2.9 a resolution
PDB Compounds: (F:) 4E10 Fab light chain

SCOPe Domain Sequences for d4xcnf1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4xcnf1 b.1.1.1 (F:1-106) automated matches {Human (Homo sapiens) [TaxId: 9606]}
eivltqspgtqslspgeratlscrasqsvgnnklawyqqrpgqaprlliygassrpsgva
drfsgsgsgtdftltisrlepedfavyycqqygqslstfgqgtkvev

SCOPe Domain Coordinates for d4xcnf1:

Click to download the PDB-style file with coordinates for d4xcnf1.
(The format of our PDB-style files is described here.)

Timeline for d4xcnf1: