Class b: All beta proteins [48724] (177 folds) |
Fold b.60: Lipocalins [50813] (1 superfamily) barrel, closed or opened; n=8, S=12; meander |
Superfamily b.60.1: Lipocalins [50814] (10 families) bind hydrophobic ligands in their interior |
Family b.60.1.2: Fatty acid binding protein-like [50847] (18 proteins) ten-stranded meander beta-sheet folded upon itself relates to the common fold by opening the barrel and insertion of beta-hairpin |
Protein Cellular retinoic-acid-binding protein (CRABP) [50861] (2 species) |
Species Human (Homo sapiens), CRABP-II [TaxId:9606] [50862] (52 PDB entries) |
Domain d4yfra_: 4yfr A: [312015] automated match to d4i9sa_ complexed with ret; mutant |
PDB Entry: 4yfr (more details), 1.95 Å
SCOPe Domain Sequences for d4yfra_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4yfra_ b.60.1.2 (A:) Cellular retinoic-acid-binding protein (CRABP) {Human (Homo sapiens), CRABP-II [TaxId: 9606]} pnfsgnwkiirsenfeellkvlgvnvmlrkiavaaaskyaveikqegdtfyikvsttvyt teinfkvgeefeeqtvdgrpckslvkwesenkmvceqkllkgegpktswtkeltndgeli ltmtaddvvctqvfvre
Timeline for d4yfra_: