SCOPe 2.06: Domain d4yh2b1: 4yh2 B:3-87

Lineage for d4yh2b1 (4yh2 B:3-87)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest

4. Superfamily c.47.1: Thioredoxin-like [52833] (24 families)

5. Family c.47.1.0: automated matches [191312] (1 protein)
   not a true family

6. Protein automated matches [190056] (165 species)
   not a true protein

7. Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [225708] (8 PDB entries)

8. Domain d4yh2b1: 4yh2 B:3-87 [312010]
   Other proteins in same PDB: d4yh2a2, d4yh2b2, d4yh2c2, d4yh2d2
   automated match to d4pnfa1
   complexed with gsh

Details for d4yh2b1

PDB Entry: 4yh2, 1.72 Å

PDB Description: glutathione transferase e6 from drosophila melanogaster

PDB Compounds: (B:) Glutathione S transferase E6

SCOPe Domain Sequences for d4yh2b1:

Sequence; same for both SEQRES and ATOM records:

>d4yh2b1 c.47.1.0 (B:3-87) automated matches {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
kltlygldpsppvravkltlaalnltyeyvnvdivaraqlspeyleknpqhtvptleddg
hyiwdshaiiaylvskyadsdalyp

Timeline for d4yh2b1:

• d4yh2b1 is new in SCOPe 2.06-stable
  
• d4yh2b1 appears in SCOPe 2.07
  
• d4yh2b1 appears in the current release, SCOPe 2.08