Lineage for d4yc1c_ (4yc1 C:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2546033Fold d.20: UBC-like [54494] (1 superfamily)
    alpha-beta(4)-alpha(3); core: meander beta-sheet plus one helix 2
  4. 2546034Superfamily d.20.1: UBC-like [54495] (5 families) (S)
  5. 2546459Family d.20.1.2: UEV domain [75383] (3 proteins)
  6. 2546460Protein Tumor susceptibility gene 101 (TSG101) [75384] (1 species)
  7. 2546461Species Human (Homo sapiens) [TaxId:9606] [75385] (14 PDB entries)
  8. 2546473Domain d4yc1c_: 4yc1 C: [312009]
    Other proteins in same PDB: d4yc1a2, d4yc1b2
    automated match to d1m4qa_
    complexed with so4

Details for d4yc1c_

PDB Entry: 4yc1 (more details), 2 Å

PDB Description: structure of the human tsg101-uev domain in the p321 space group
PDB Compounds: (C:) Tumor susceptibility gene 101 protein

SCOPe Domain Sequences for d4yc1c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4yc1c_ d.20.1.2 (C:) Tumor susceptibility gene 101 (TSG101) {Human (Homo sapiens) [TaxId: 9606]}
vsesqlkkmvskykyrdltvretvnvitlykdlkpvldsyvfndgssrelmnltgtipvp
yrgntynipiclwlldtypynppicfvkptssmtiktgkhvdangkiylpylhewkhpqs
dllgliqvmivvfgdeppvfsrp

SCOPe Domain Coordinates for d4yc1c_:

Click to download the PDB-style file with coordinates for d4yc1c_.
(The format of our PDB-style files is described here.)

Timeline for d4yc1c_: