Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.20: UBC-like [54494] (1 superfamily) alpha-beta(4)-alpha(3); core: meander beta-sheet plus one helix 2 |
Superfamily d.20.1: UBC-like [54495] (5 families) |
Family d.20.1.2: UEV domain [75383] (3 proteins) |
Protein Tumor susceptibility gene 101 (TSG101) [75384] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [75385] (14 PDB entries) |
Domain d4yc1c_: 4yc1 C: [312009] Other proteins in same PDB: d4yc1a2, d4yc1b2 automated match to d1m4qa_ complexed with so4 |
PDB Entry: 4yc1 (more details), 2 Å
SCOPe Domain Sequences for d4yc1c_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4yc1c_ d.20.1.2 (C:) Tumor susceptibility gene 101 (TSG101) {Human (Homo sapiens) [TaxId: 9606]} vsesqlkkmvskykyrdltvretvnvitlykdlkpvldsyvfndgssrelmnltgtipvp yrgntynipiclwlldtypynppicfvkptssmtiktgkhvdangkiylpylhewkhpqs dllgliqvmivvfgdeppvfsrp
Timeline for d4yc1c_:
View in 3D Domains from other chains: (mouse over for more information) d4yc1a1, d4yc1a2, d4yc1b1, d4yc1b2 |