Lineage for d4y99b_ (4y99 B:)

  1. Root: SCOPe 2.08
  2. 3039230Class h: Coiled coil proteins [57942] (7 folds)
  3. 3039231Fold h.1: Parallel coiled-coil [57943] (41 superfamilies)
    this is not a true fold; includes oligomers of shorter identical helices
  4. 3040519Superfamily h.1.25: Troponin coil-coiled subunits [90250] (2 families) (S)
    form heterodimeric coiled coil
  5. 3040520Family h.1.25.1: Troponin T [90251] (1 protein)
  6. 3040521Protein Troponin T [90252] (2 species)
  7. 3040525Species Human (Homo sapiens) [TaxId:9606] [90253] (3 PDB entries)
  8. 3040526Domain d4y99b_: 4y99 B: [312002]
    Other proteins in same PDB: d4y99a_
    automated match to d1j1de_
    complexed with ca, dms

Details for d4y99b_

PDB Entry: 4y99 (more details), 2 Å

PDB Description: core domain of human cardiac troponin
PDB Compounds: (B:) Troponin T, cardiac muscle

SCOPe Domain Sequences for d4y99b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4y99b_ h.1.25.1 (B:) Troponin T {Human (Homo sapiens) [TaxId: 9606]}
gkrqterekkkkilaerrkvlaidhlnedqlrekakelwqtiynleaekfdlqekfkqqk
yeinvlrnrindnq

SCOPe Domain Coordinates for d4y99b_:

Click to download the PDB-style file with coordinates for d4y99b_.
(The format of our PDB-style files is described here.)

Timeline for d4y99b_: