SCOPe 2.01: Domain d2fvxa_: 2fvx A:

Lineage for d2fvxa_ (2fvx A:)

1. Root: SCOPe 2.01

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
   3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345

4. Superfamily c.23.5: Flavoproteins [52218] (9 families)

5. Family c.23.5.1: Flavodoxin-related [52219] (6 proteins)
   binds FMN

6. Protein Flavodoxin [52220] (9 species)

7. Species Clostridium beijerinckii [TaxId:1520] [52226] (16 PDB entries)

8. Domain d2fvxa_: 2fvx A: [31200]
   complexed with fmn; mutant

Details for d2fvxa_

PDB Entry: 2fvx, 1.8 Å

PDB Description: clostridium beijerinckii flavodoxin mutant: g57t reduced (277k)

PDB Compounds: (A:) flavodoxin

SCOPe Domain Sequences for d2fvxa_:

Sequence; same for both SEQRES and ATOM records:

>d2fvxa_ c.23.5.1 (A:) Flavodoxin {Clostridium beijerinckii [TaxId: 1520]}
mkivywsgtgntekmaeliakgiiesgkdvntinvsdvnidellnedililgcsamtdev
leesefepfieeistkisgkkvalfgsygwgdgkwmrdfeermngygcvvvetplivqne
pdeaeqdciefgkkiani

Timeline for d2fvxa_:

• d2fvxa_ first appeared (with stable ids) in SCOP 1.55, called d2fvx__
  
• d2fvxa_ appears in SCOP 1.75
  
• d2fvxa_ appears in SCOPe 2.02
  
• d2fvxa_ appears in the current release, SCOPe 2.08