Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
Fold c.23: Flavodoxin-like [52171] (15 superfamilies) 3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345 |
Superfamily c.23.5: Flavoproteins [52218] (9 families) |
Family c.23.5.1: Flavodoxin-related [52219] (6 proteins) binds FMN |
Protein Flavodoxin [52220] (9 species) |
Species Clostridium beijerinckii [TaxId:1520] [52226] (16 PDB entries) |
Domain d2fvxa_: 2fvx A: [31200] complexed with fmn; mutant |
PDB Entry: 2fvx (more details), 1.8 Å
SCOPe Domain Sequences for d2fvxa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2fvxa_ c.23.5.1 (A:) Flavodoxin {Clostridium beijerinckii [TaxId: 1520]} mkivywsgtgntekmaeliakgiiesgkdvntinvsdvnidellnedililgcsamtdev leesefepfieeistkisgkkvalfgsygwgdgkwmrdfeermngygcvvvetplivqne pdeaeqdciefgkkiani
Timeline for d2fvxa_: