Lineage for d4yeka3 (4yek A:336-440)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2944850Fold d.41: alpha/beta-Hammerhead [54664] (5 superfamilies)
    core: beta-BETA-alpha-beta-BETA-beta-alpha; contains a beta-hammerhead motif similar to that in barrel-sandwich hybrids
  4. 2945237Superfamily d.41.3: Pyrimidine nucleoside phosphorylase C-terminal domain [54680] (2 families) (S)
  5. 2945255Family d.41.3.0: automated matches [254277] (1 protein)
    not a true family
  6. 2945256Protein automated matches [254643] (6 species)
    not a true protein
  7. 2945269Species Salmonella enterica [TaxId:90371] [311686] (2 PDB entries)
  8. 2945272Domain d4yeka3: 4yek A:336-440 [311992]
    Other proteins in same PDB: d4yeka1, d4yeka2, d4yekb1, d4yekb2
    automated match to d4x46b3
    complexed with edo, gol, pge, so4, thm

Details for d4yeka3

PDB Entry: 4yek (more details), 2.55 Å

PDB Description: x-ray structure of the thymidine phosphorylase from salmonella typhimurium in complex with thymidine
PDB Compounds: (A:) thymidine phosphorylase

SCOPe Domain Sequences for d4yeka3:

Sequence; same for both SEQRES and ATOM records: (download)

>d4yeka3 d.41.3.0 (A:336-440) automated matches {Salmonella enterica [TaxId: 90371]}
tamlskavyadtegfisamdtralgmavvsmgggrrqasdtidysvgftdmarlgdsidg
qrplavihakdeaswqeaakavkaaiilddkapastpsvyrrite

SCOPe Domain Coordinates for d4yeka3:

Click to download the PDB-style file with coordinates for d4yeka3.
(The format of our PDB-style files is described here.)

Timeline for d4yeka3: