SCOPe 2.08: Domain d4yeka3: 4yek A:336-440

Lineage for d4yeka3 (4yek A:336-440)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.41: alpha/beta-Hammerhead [54664] (5 superfamilies)
   core: beta-BETA-alpha-beta-BETA-beta-alpha; contains a beta-hammerhead motif similar to that in barrel-sandwich hybrids

4. Superfamily d.41.3: Pyrimidine nucleoside phosphorylase C-terminal domain [54680] (2 families)

5. Family d.41.3.0: automated matches [254277] (1 protein)
   not a true family

6. Protein automated matches [254643] (6 species)
   not a true protein

7. Species Salmonella enterica [TaxId:90371] [311686] (2 PDB entries)

8. Domain d4yeka3: 4yek A:336-440 [311992]
   Other proteins in same PDB: d4yeka1, d4yeka2, d4yekb1, d4yekb2
   automated match to d4x46b3
   complexed with edo, gol, pge, so4, thm

Details for d4yeka3

PDB Entry: 4yek, 2.55 Å

PDB Description: x-ray structure of the thymidine phosphorylase from salmonella typhimurium in complex with thymidine

PDB Compounds: (A:) thymidine phosphorylase

SCOPe Domain Sequences for d4yeka3:

Sequence; same for both SEQRES and ATOM records:

>d4yeka3 d.41.3.0 (A:336-440) automated matches {Salmonella enterica [TaxId: 90371]}
tamlskavyadtegfisamdtralgmavvsmgggrrqasdtidysvgftdmarlgdsidg
qrplavihakdeaswqeaakavkaaiilddkapastpsvyrrite

Timeline for d4yeka3:

• d4yeka3 first appeared in SCOPe 2.06
  
• d4yeka3 appears in SCOPe 2.07