Lineage for d4yeka2 (4yek A:71-335)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2861697Fold c.27: Nucleoside phosphorylase/phosphoribosyltransferase catalytic domain [52417] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 5 strands, order 32145; Rossmann-like
  4. 2861698Superfamily c.27.1: Nucleoside phosphorylase/phosphoribosyltransferase catalytic domain [52418] (2 families) (S)
    automatically mapped to Pfam PF00591
  5. 2861699Family c.27.1.1: Nucleoside phosphorylase/phosphoribosyltransferase catalytic domain [52419] (4 proteins)
  6. 2861758Protein automated matches [254642] (4 species)
    not a true protein
  7. 2861766Species Salmonella enterica [TaxId:90371] [311684] (2 PDB entries)
  8. 2861769Domain d4yeka2: 4yek A:71-335 [311991]
    Other proteins in same PDB: d4yeka1, d4yeka3, d4yekb1, d4yekb3
    automated match to d4x46b2
    complexed with edo, gol, pge, so4, thm

Details for d4yeka2

PDB Entry: 4yek (more details), 2.55 Å

PDB Description: x-ray structure of the thymidine phosphorylase from salmonella typhimurium in complex with thymidine
PDB Compounds: (A:) thymidine phosphorylase

SCOPe Domain Sequences for d4yeka2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4yeka2 c.27.1.1 (A:71-335) automated matches {Salmonella enterica [TaxId: 90371]}
dwkslnlngpivdkhstggvgdvtslmlgpmvaacggyvpmisgrglghtggtldkleai
pgfdifpddnrfreiiqdvgvaiigqtsslapadkrfyatrditatvdsiplitgsilak
klaegldalvmdvkvgsgafmptyelsealaeaivgvangagvrttalltdmnqvlassa
gnavevreavqfltgeyrnprlfdvtmalcvemlisgqlakddaearaklqavldngkaa
evfgrmvaaqkgpsdfvenydkylp

SCOPe Domain Coordinates for d4yeka2:

Click to download the PDB-style file with coordinates for d4yeka2.
(The format of our PDB-style files is described here.)

Timeline for d4yeka2: