SCOPe 2.06: Domain d4yeka1: 4yek A:1-70

Lineage for d4yeka1 (4yek A:1-70)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.46: Methionine synthase domain-like [47643] (3 superfamilies)
   4 helices; bundle, left-handed twist; right-handed superhelix

4. Superfamily a.46.2: Nucleoside phosphorylase/phosphoribosyltransferase N-terminal domain [47648] (2 families)
   automatically mapped to Pfam PF02885

5. Family a.46.2.0: automated matches [254276] (1 protein)
   not a true family

6. Protein automated matches [254641] (5 species)
   not a true protein

7. Species Salmonella enterica [TaxId:90371] [311682] (2 PDB entries)

8. Domain d4yeka1: 4yek A:1-70 [311990]
   Other proteins in same PDB: d4yeka2, d4yeka3, d4yekb2, d4yekb3
   automated match to d4x46b1
   complexed with edo, gol, pge, so4, thm

Details for d4yeka1

PDB Entry: 4yek, 2.55 Å

PDB Description: x-ray structure of the thymidine phosphorylase from salmonella typhimurium in complex with thymidine

PDB Compounds: (A:) thymidine phosphorylase

SCOPe Domain Sequences for d4yeka1:

Sequence; same for both SEQRES and ATOM records:

>d4yeka1 a.46.2.0 (A:1-70) automated matches {Salmonella enterica [TaxId: 90371]}
mflaqeiirkkrdghalsdeeirffingirdntisegqiaalamtiffhdmtmpervslt
mamrdsgtvl

Timeline for d4yeka1:

• d4yeka1 is new in SCOPe 2.06-stable
  
• d4yeka1 appears in SCOPe 2.07
  
• d4yeka1 appears in the current release, SCOPe 2.08