Lineage for d4yeka1 (4yek A:1-70)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2000161Fold a.46: Methionine synthase domain-like [47643] (3 superfamilies)
    4 helices; bundle, left-handed twist; right-handed superhelix
  4. 2000172Superfamily a.46.2: Nucleoside phosphorylase/phosphoribosyltransferase N-terminal domain [47648] (2 families) (S)
    automatically mapped to Pfam PF02885
  5. 2000232Family a.46.2.0: automated matches [254276] (1 protein)
    not a true family
  6. 2000233Protein automated matches [254641] (5 species)
    not a true protein
  7. 2000244Species Salmonella enterica [TaxId:90371] [311682] (2 PDB entries)
  8. 2000247Domain d4yeka1: 4yek A:1-70 [311990]
    Other proteins in same PDB: d4yeka2, d4yeka3, d4yekb2, d4yekb3
    automated match to d4x46b1
    complexed with edo, gol, pge, so4, thm

Details for d4yeka1

PDB Entry: 4yek (more details), 2.55 Å

PDB Description: x-ray structure of the thymidine phosphorylase from salmonella typhimurium in complex with thymidine
PDB Compounds: (A:) thymidine phosphorylase

SCOPe Domain Sequences for d4yeka1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4yeka1 a.46.2.0 (A:1-70) automated matches {Salmonella enterica [TaxId: 90371]}
mflaqeiirkkrdghalsdeeirffingirdntisegqiaalamtiffhdmtmpervslt
mamrdsgtvl

SCOPe Domain Coordinates for d4yeka1:

Click to download the PDB-style file with coordinates for d4yeka1.
(The format of our PDB-style files is described here.)

Timeline for d4yeka1: