![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily) sandwich; 12-14 strands in 2 sheets; complex topology |
![]() | Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (27 families) ![]() |
![]() | Family b.29.1.13: Lectin leg-like [74904] (4 proteins) mammalian protein related to legume lectins automatically mapped to Pfam PF03388 |
![]() | Protein automated matches [190462] (2 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [197238] (11 PDB entries) |
![]() | Domain d4ygde_: 4ygd E: [311989] automated match to d4gkya_ complexed with ca, cl |
PDB Entry: 4ygd (more details), 2.51 Å
SCOPe Domain Sequences for d4ygde_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4ygde_ b.29.1.13 (E:) automated matches {Human (Homo sapiens) [TaxId: 9606]} phrrfeykysfkgphlvqsdgtvpfwahagnaipssdqirvapslksqrgsvwtktkaaf enwevevtfrvtgrgrigadglaiwyaenqglegpvfgsadlwngvgiffdsfdndgkkn npaiviignngqihydhqndgasqalascqrdfrnkpypvrakityyqntltvminngft pdkndyefcakvenmiipaqghfgisaatggladdhdvlsfltfqlt
Timeline for d4ygde_: