Lineage for d4xtpa_ (4xtp A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2778274Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 2778275Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (27 families) (S)
  5. 2780621Family b.29.1.0: automated matches [191363] (1 protein)
    not a true family
  6. 2780622Protein automated matches [190437] (70 species)
    not a true protein
  7. 2781425Species Vatairea macrocarpa [TaxId:77050] [268912] (6 PDB entries)
  8. 2781432Domain d4xtpa_: 4xtp A: [311985]
    automated match to d3n35a_
    complexed with a2g, ca, cit, mn, ser, so4

Details for d4xtpa_

PDB Entry: 4xtp (more details), 1.97 Å

PDB Description: crystal structure of a recombinant vatairea macrocarpa seed lectin complexed with tn antigen
PDB Compounds: (A:) seed lectin

SCOPe Domain Sequences for d4xtpa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4xtpa_ b.29.1.0 (A:) automated matches {Vatairea macrocarpa [TaxId: 77050]}
sevvsfsftkfnpnpkdiilqgdalvtskgklqltkvkdgkpvdhslgralyaapihiwd
dstdrvasfatsfsfvveapdesktadgiafflappdtqpqkdggflglfndsnksiqtv
avefdtfsntwdpsarhiginvnsiesmkyvkwgwengkvanvyisyeastktltaslty
psnatsyivsanvdlksalpewvrvgfsatsglsrdhvethdvldwsftstlqa

SCOPe Domain Coordinates for d4xtpa_:

Click to download the PDB-style file with coordinates for d4xtpa_.
(The format of our PDB-style files is described here.)

Timeline for d4xtpa_: