![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily) sandwich; 12-14 strands in 2 sheets; complex topology |
![]() | Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (27 families) ![]() |
![]() | Family b.29.1.0: automated matches [191363] (1 protein) not a true family |
![]() | Protein automated matches [190437] (70 species) not a true protein |
![]() | Species Vatairea macrocarpa [TaxId:77050] [268912] (6 PDB entries) |
![]() | Domain d4xtpa_: 4xtp A: [311985] automated match to d3n35a_ complexed with a2g, ca, cit, mn, ser, so4 |
PDB Entry: 4xtp (more details), 1.97 Å
SCOPe Domain Sequences for d4xtpa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4xtpa_ b.29.1.0 (A:) automated matches {Vatairea macrocarpa [TaxId: 77050]} sevvsfsftkfnpnpkdiilqgdalvtskgklqltkvkdgkpvdhslgralyaapihiwd dstdrvasfatsfsfvveapdesktadgiafflappdtqpqkdggflglfndsnksiqtv avefdtfsntwdpsarhiginvnsiesmkyvkwgwengkvanvyisyeastktltaslty psnatsyivsanvdlksalpewvrvgfsatsglsrdhvethdvldwsftstlqa
Timeline for d4xtpa_: