Lineage for d4yb7l1 (4yb7 L:5-224)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2913607Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
    consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
    mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest
  4. 2913608Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) (S)
    Similar in architecture to the superfamily I but partly differs in topology
  5. 2915150Family c.94.1.0: automated matches [191309] (1 protein)
    not a true family
  6. 2915151Protein automated matches [190039] (161 species)
    not a true protein
  7. 2915348Species Campylobacter jejuni [TaxId:195099] [311908] (7 PDB entries)
  8. 2915374Domain d4yb7l1: 4yb7 L:5-224 [311981]
    Other proteins in same PDB: d4yb7a2, d4yb7b2, d4yb7c2, d4yb7d2, d4yb7e2, d4yb7f2, d4yb7g2, d4yb7h2, d4yb7i2, d4yb7j2, d4yb7k2, d4yb7l2
    automated match to d1h3da1
    complexed with acy, atp, mg, po4

Details for d4yb7l1

PDB Entry: 4yb7 (more details), 2.2 Å

PDB Description: adenosine triphosphate phosphoribosyltransferase from campylobacter jejuni in complex with atp
PDB Compounds: (L:) ATP phosphoribosyltransferase

SCOPe Domain Sequences for d4yb7l1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4yb7l1 c.94.1.0 (L:5-224) automated matches {Campylobacter jejuni [TaxId: 195099]}
trlriaiqksgrlskesiellsecgvkmhiheqsliafstnlpidilrvrdddipglifd
gvvdlgiigenvleenelerqslgenpsykllkkldfgycrlslalpqenkfqnlkdfeg
lriatsypqllkrfmkenginyknctltgsvevapranladaicdlvssgatlqannlke
vkviyesracliqkenalskekqalvdkimlrvagvmqar

SCOPe Domain Coordinates for d4yb7l1:

Click to download the PDB-style file with coordinates for d4yb7l1.
(The format of our PDB-style files is described here.)

Timeline for d4yb7l1: