![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
![]() | Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) ![]() |
![]() | Family c.2.1.0: automated matches [191313] (1 protein) not a true family |
![]() | Protein automated matches [190069] (243 species) not a true protein |
![]() | Species Sphingobium sp. [TaxId:627192] [311972] (5 PDB entries) |
![]() | Domain d4y9da_: 4y9d A: [311973] automated match to d3rwba_ complexed with nai |
PDB Entry: 4y9d (more details), 2.01 Å
SCOPe Domain Sequences for d4y9da_:
Sequence, based on SEQRES records: (download)
>d4y9da_ c.2.1.0 (A:) automated matches {Sphingobium sp. [TaxId: 627192]} dfqdqvafitggasgagfgqakvfgqagakivvadvraeavekavaeleglgitahgivl dimdreayaraadeveavfgqaptllsntagvnsfgpiekttyddfdwiigvnlngving mvtfvprmiasgrpghivtvsslggfmgsalagpysaakaasinlmegyrqglekygigv svctpaniksniaeasrlrpakygtsgyveneesiaslhsihqhglepeklaeaikkgve dnalyiipypevreglekhfqaiidsvapm
>d4y9da_ c.2.1.0 (A:) automated matches {Sphingobium sp. [TaxId: 627192]} dfqdqvafitggasgagfgqakvfgqagakivvadvraeavekavaeleglgitahgivl dimdreayaraadeveavfgqaptllsntagvnsfgpiekttyddfdwiigvnlngving mvtfvprmiasgrpghivtvsslggfmgsalagpysaakaasinlmegyrqglekygigv svctpanihglepeklaeaikkgvednalyiipypevreglekhfqaiidsvapm
Timeline for d4y9da_: