SCOPe 2.08: Domain d2foxa_: 2fox A:

Lineage for d2foxa_ (2fox A:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
   3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345

4. Superfamily c.23.5: Flavoproteins [52218] (9 families)

5. Family c.23.5.1: Flavodoxin-related [52219] (6 proteins)
   binds FMN

6. Protein Flavodoxin [52220] (11 species)

7. Species Clostridium beijerinckii [TaxId:1520] [52226] (16 PDB entries)

8. Domain d2foxa_: 2fox A: [31197]
   complexed with fmn

Details for d2foxa_

PDB Entry: 2fox, 1.8 Å

PDB Description: clostridium beijerinckii flavodoxin: semiquinone

PDB Compounds: (A:) flavodoxin

SCOPe Domain Sequences for d2foxa_:

Sequence; same for both SEQRES and ATOM records:

>d2foxa_ c.23.5.1 (A:) Flavodoxin {Clostridium beijerinckii [TaxId: 1520]}
mkivywsgtgntekmaeliakgiiesgkdvntinvsdvnidellnedililgcsamgdev
leesefepfieeistkisgkkvalfgsygwgdgkwmrdfeermngygcvvvetplivqne
pdeaeqdciefgkkiani

Timeline for d2foxa_:

• d2foxa_ first appeared (with stable ids) in SCOP 1.55, called d2fox__
  
• d2foxa_ appears in SCOPe 2.07