Lineage for d4ydaa_ (4yda A:)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2395396Fold b.60: Lipocalins [50813] (1 superfamily)
    barrel, closed or opened; n=8, S=12; meander
  4. 2395397Superfamily b.60.1: Lipocalins [50814] (10 families) (S)
    bind hydrophobic ligands in their interior
  5. 2395948Family b.60.1.2: Fatty acid binding protein-like [50847] (18 proteins)
    ten-stranded meander beta-sheet folded upon itself
    relates to the common fold by opening the barrel and insertion of beta-hairpin
  6. 2396009Protein Cellular retinoic-acid-binding protein (CRABP) [50861] (2 species)
  7. 2396016Species Human (Homo sapiens), CRABP-II [TaxId:9606] [50862] (71 PDB entries)
  8. 2396076Domain d4ydaa_: 4yda A: [311965]
    automated match to d4i9sa_
    complexed with ret; mutant

Details for d4ydaa_

PDB Entry: 4yda (more details), 1.95 Å

PDB Description: crystal structure of r111k:y134f:t54v:r132q:p39q:r59y mutant of human cellular retinoic acid binding proteinii with retinal at 1.95 angstrom - after 1hour visible light irradiation - 3rd cycle
PDB Compounds: (A:) Cellular retinoic acid-binding protein 2

SCOPe Domain Sequences for d4ydaa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4ydaa_ b.60.1.2 (A:) Cellular retinoic-acid-binding protein (CRABP) {Human (Homo sapiens), CRABP-II [TaxId: 9606]}
pnfsgnwkiirsenfeellkvlgvnvmlrkiavaaaskqaveikqegdtfyikvsttvyt
teinfkvgeefeeqtvdgrpckslvkwesenkmvceqkllkgegpktswtkeltndgeli
ltmtaddvvctqvfvre

SCOPe Domain Coordinates for d4ydaa_:

Click to download the PDB-style file with coordinates for d4ydaa_.
(The format of our PDB-style files is described here.)

Timeline for d4ydaa_: