Lineage for d4y0we2 (4y0w E:109-214)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2491249Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 2491250Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families) (S)
    duplication contains two domains of this fold
  5. 2492670Family c.55.1.0: automated matches [227137] (1 protein)
    not a true family
  6. 2492671Protein automated matches [226839] (63 species)
    not a true protein
  7. 2493317Species Pseudomonas aeruginosa [TaxId:1191475] [311877] (1 PDB entry)
  8. 2493327Domain d4y0we2: 4y0w E:109-214 [311963]
    automated match to d4ydud2
    complexed with na

Details for d4y0we2

PDB Entry: 4y0w (more details), 2.5 Å

PDB Description: yeaz from pseudomonas aeruginosa
PDB Compounds: (E:) YeaZ

SCOPe Domain Sequences for d4y0we2:

Sequence, based on SEQRES records: (download)

>d4y0we2 c.55.1.0 (E:109-214) automated matches {Pseudomonas aeruginosa [TaxId: 1191475]}
aervaaaidarmdevywgcyqlqqgemrlagseavlppervavpwdaaaadwfgagtgwg
yvermpqrpvaldasllphaedllslagfawargegveaeqalpvy

Sequence, based on observed residues (ATOM records): (download)

>d4y0we2 c.55.1.0 (E:109-214) automated matches {Pseudomonas aeruginosa [TaxId: 1191475]}
aervaaaidarmdevywgcyqlqqgemrlagseavlppervavpwdaadwfgagtgwgyv
ermpqrpvaldasllphaedllslagfawargegveaeqalpvy

SCOPe Domain Coordinates for d4y0we2:

Click to download the PDB-style file with coordinates for d4y0we2.
(The format of our PDB-style files is described here.)

Timeline for d4y0we2: