Lineage for d4yc1a1 (4yc1 A:1-145)

  1. Root: SCOPe 2.08
  2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. Fold d.20: UBC-like [54494] (1 superfamily)
    alpha-beta(4)-alpha(3); core: meander beta-sheet plus one helix 2
  4. Superfamily d.20.1: UBC-like [54495] (5 families) (S)
  5. Family d.20.1.2: UEV domain [75383] (3 proteins)
  6. Protein Tumor susceptibility gene 101 (TSG101) [75384] (1 species)
  7. Species Human (Homo sapiens) [TaxId:9606] [75385] (14 PDB entries)
  8. Domain d4yc1a1: 4yc1 A:1-145 [311948]
    Other proteins in same PDB: d4yc1a2, d4yc1b2
    automated match to d1m4qa_
    complexed with so4

Details for d4yc1a1

PDB Entry: 4yc1 (more details), 2 Å

PDB Description: structure of the human tsg101-uev domain in the p321 space group
PDB Compounds: (A:) Tumor susceptibility gene 101 protein

SCOPe Domain Sequences for d4yc1a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4yc1a1 d.20.1.2 (A:1-145) Tumor susceptibility gene 101 (TSG101) {Human (Homo sapiens) [TaxId: 9606]}
mavsesqlkkmvskykyrdltvretvnvitlykdlkpvldsyvfndgssrelmnltgtip
vpyrgntynipiclwlldtypynppicfvkptssmtiktgkhvdangkiylpylhewkhp
qsdllgliqvmivvfgdeppvfsrp

SCOPe Domain Coordinates for d4yc1a1 are not available.

Timeline for d4yc1a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d4yc1a2
View in 3D
Domains from other chains:
(mouse over for more information)
d4yc1b1, d4yc1b2, d4yc1c_