Class b: All beta proteins [48724] (180 folds) |
Fold b.43: Reductase/isomerase/elongation factor common domain [50412] (4 superfamilies) barrel, closed; n=6, S=10; greek-key |
Superfamily b.43.4: Riboflavin synthase domain-like [63380] (4 families) |
Family b.43.4.1: NADPH-cytochrome p450 reductase FAD-binding domain-like [50438] (4 proteins) there is an alpha-helical subdomain inserted in this domain automatically mapped to Pfam PF00667 |
Protein automated matches [227066] (2 species) not a true protein |
Species Norway rat (Rattus norvegicus) [TaxId:10116] [256000] (16 PDB entries) |
Domain d4yaua2: 4yau A:240-518 [311946] Other proteins in same PDB: d4yaua1, d4yaua3, d4yaub1, d4yaub3 automated match to d1j9za1 complexed with 2am, fad, fmn, po4; mutant |
PDB Entry: 4yau (more details), 2.2 Å
SCOPe Domain Sequences for d4yaua2:
Sequence, based on SEQRES records: (download)
>d4yaua2 b.43.4.1 (A:240-518) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]} ssirqyelvvhedmdvakvytgemgrlksyenqkppfdaknpflaavtanrklnqgterh lmhleldisdskiryesgdhvavypandsalvnqigeilgadldvimslnnldeesnkkh pfpcpttyrtaltyylditnpprtnvlyelaqyasepseqehlhkmasssgegkelylsw vvearrhilailqdypslrppidhlcellprlqaryysiassskvhpnsvhicavaveye aksgrvnkgvatswlrakepagenggralvpmfvrksqf
>d4yaua2 b.43.4.1 (A:240-518) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]} ssirqyelvvhedmdvakvytgemgrlksyenqkppfdaknpflaavtanrklnqgterh lmhleldisdskiryesgdhvavypandsalvnqigeilgadldvimslnnldeesnkkh pfpcpttyrtaltyylditnpprtnvlyelaqyasepseqehlhkmasssgegkelylsw vvearrhilailqdypslrppidhlcellprlqaryysiassskvhpnsvhicavaveye aksgrvnkgvatswlrakepagralvpmfvrksqf
Timeline for d4yaua2: