SCOPe 2.06: Domain d4yaua1: 4yau A:62-236

Lineage for d4yaua1 (4yau A:62-236)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
   3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345

4. Superfamily c.23.5: Flavoproteins [52218] (9 families)

5. Family c.23.5.0: automated matches [191330] (1 protein)
   not a true family

6. Protein automated matches [190158] (24 species)
   not a true protein

7. Species Norway rat (Rattus norvegicus) [TaxId:10116] [255999] (10 PDB entries)

8. Domain d4yaua1: 4yau A:62-236 [311945]
   Other proteins in same PDB: d4yaua2, d4yaua3, d4yaub2, d4yaub3
   automated match to d1ja1a2
   complexed with 2am, fad, fmn, po4; mutant

Details for d4yaua1

PDB Entry: 4yau, 2.2 Å

PDB Description: reduced cypor mutant - g141del/e142n

PDB Compounds: (A:) NADPH--cytochrome P450 reductase

SCOPe Domain Sequences for d4yaua1:

Sequence; same for both SEQRES and ATOM records:

>d4yaua1 c.23.5.0 (A:62-236) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]}
ppvkessfvekmkktgrniivfygsqtgtaeefanrlskdahrygmrgmsadpeeydlad
lsslpeidkslvvfcmatyngdptdnaqdfydwlqetdvdltgvkfavfglgnktyehfn
amgkyvdqrleqlgaqrifelglgdddgnleedfitwreqfwpavceffgveat

Timeline for d4yaua1:

• d4yaua1 is new in SCOPe 2.06-stable
  
• d4yaua1 appears in SCOPe 2.07
  
• d4yaua1 appears in the current release, SCOPe 2.08