Lineage for d4ybhb_ (4ybh B:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1996349Fold a.39: EF Hand-like [47472] (4 superfamilies)
    core: 4 helices; array of 2 hairpins, opened
  4. 1996350Superfamily a.39.1: EF-hand [47473] (12 families) (S)
    Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop
  5. 1996383Family a.39.1.2: S100 proteins [47478] (2 proteins)
    dimer: subunits are made of two EF-hands
  6. 1996615Protein automated matches [190132] (4 species)
    not a true protein
  7. 1996618Species Human (Homo sapiens) [TaxId:9606] [187203] (42 PDB entries)
  8. 1996697Domain d4ybhb_: 4ybh B: [311943]
    automated match to d1a03a_
    complexed with act, ca, cl, zn

Details for d4ybhb_

PDB Entry: 4ybh (more details), 2.4 Å

PDB Description: crystal structure of the human rage ectodomain (vc1c2 fragment) in complex with human s100a6
PDB Compounds: (B:) Protein S100-A6

SCOPe Domain Sequences for d4ybhb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4ybhb_ a.39.1.2 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
acpldqaigllvaifhkysgregdkhtlskkelkeliqkeltigsklqdaeiarlmedld
rnkdqevnfqeyvtflgalaliynealkg

SCOPe Domain Coordinates for d4ybhb_:

Click to download the PDB-style file with coordinates for d4ybhb_.
(The format of our PDB-style files is described here.)

Timeline for d4ybhb_: