Lineage for d4yawb1 (4yaw B:67-235)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2438294Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 2439108Superfamily c.23.5: Flavoproteins [52218] (9 families) (S)
  5. 2439628Family c.23.5.0: automated matches [191330] (1 protein)
    not a true family
  6. 2439629Protein automated matches [190158] (24 species)
    not a true protein
  7. 2439733Species Norway rat (Rattus norvegicus) [TaxId:10116] [255999] (15 PDB entries)
  8. 2439743Domain d4yawb1: 4yaw B:67-235 [311936]
    Other proteins in same PDB: d4yawa2, d4yawa3, d4yawb2, d4yawb3
    automated match to d1ja1a2
    complexed with 2am, fad, fmn, po4; mutant

Details for d4yawb1

PDB Entry: 4yaw (more details), 2 Å

PDB Description: reduced cypor mutant - g141del
PDB Compounds: (B:) NADPH--cytochrome P450 reductase

SCOPe Domain Sequences for d4yawb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4yawb1 c.23.5.0 (B:67-235) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]}
ssfvekmkktgrniivfygsqtgtaeefanrlskdahrygmrgmsadpeeydladlsslp
eidkslvvfcmatyegdptdnaqdfydwlqetdvdltgvkfavfglgnktyehfnamgky
vdqrleqlgaqrifelglgdddgnleedfitwreqfwpavceffgvea

SCOPe Domain Coordinates for d4yawb1:

Click to download the PDB-style file with coordinates for d4yawb1.
(The format of our PDB-style files is described here.)

Timeline for d4yawb1: