Lineage for d4xcnk1 (4xcn K:1-106)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2344608Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2344609Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2344610Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 protein domains)
  6. 2347168Protein automated matches [190119] (20 species)
    not a true protein
  7. 2347244Species Human (Homo sapiens) [TaxId:9606] [188740] (192 PDB entries)
  8. 2347580Domain d4xcnk1: 4xcn K:1-106 [311932]
    Other proteins in same PDB: d4xcnb2, d4xcnd2, d4xcnf2, d4xcni2, d4xcnk2, d4xcnl2
    automated match to d1dn0a1
    complexed with 44e, gol, po4, unl

Details for d4xcnk1

PDB Entry: 4xcn (more details), 2.9 Å

PDB Description: crystal structure of human 4e10 fab in complex with phosphatidic acid (06:0 pa); 2.9 a resolution
PDB Compounds: (K:) 4E10 Fab light chain

SCOPe Domain Sequences for d4xcnk1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4xcnk1 b.1.1.1 (K:1-106) automated matches {Human (Homo sapiens) [TaxId: 9606]}
eivltqspgtqslspgeratlscrasqsvgnnklawyqqrpgqaprlliygassrpsgva
drfsgsgsgtdftltisrlepedfavyycqqygqslstfgqgtkvev

SCOPe Domain Coordinates for d4xcnk1:

Click to download the PDB-style file with coordinates for d4xcnk1.
(The format of our PDB-style files is described here.)

Timeline for d4xcnk1: