Lineage for d4yb4c_ (4yb4 C:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2905791Fold c.77: Isocitrate/Isopropylmalate dehydrogenase-like [53658] (1 superfamily)
    consists of two intertwined (sub)domains related by pseudo dyad; duplication
    3 layers: a/b/a; single mixed beta-sheet of 10 strands, order 213A945867 (A=10); strands from 5 to 9 are antiparallel to the rest
  4. 2905792Superfamily c.77.1: Isocitrate/Isopropylmalate dehydrogenase-like [53659] (6 families) (S)
    the constituent families form similar dimers
  5. 2906251Family c.77.1.0: automated matches [191423] (1 protein)
    not a true family
  6. 2906252Protein automated matches [190603] (25 species)
    not a true protein
  7. 2906416Species Thermus thermophilus [TaxId:262724] [189625] (2 PDB entries)
  8. 2906423Domain d4yb4c_: 4yb4 C: [311927]
    automated match to d1x0la_
    complexed with 48y, gol, mg, nai, so4

Details for d4yb4c_

PDB Entry: 4yb4 (more details), 2.5 Å

PDB Description: crystal structure of homoisocitrate dehydrogenase from thermus thermophilus in complex with homoisocitrate, magnesium ion (ii) and nadh
PDB Compounds: (C:) Homoisocitrate dehydrogenase

SCOPe Domain Sequences for d4yb4c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4yb4c_ c.77.1.0 (C:) automated matches {Thermus thermophilus [TaxId: 262724]}
ayricliegdgighevipaarrvleatglplefveaeagwetferrgtsvpeetvekils
chatlfgaatsptrkvpgffgairylrrrldlyanvrpaksrpvpgsrpgvdlvivrent
eglyveqerryldvaiadaviskkaserigraalriaegrprktlhiahkanvlpltqgl
fldtvkevakdfplvnvqdiivdncamqlvmrperfdvivttnllgdilsdlaaglvggl
glapsgnigdttavfepvhgsapdiagkgianptaailsaammldylgekeaakrvekav
dlvlergprtpdlggdatteafteavvealksl

SCOPe Domain Coordinates for d4yb4c_:

Click to download the PDB-style file with coordinates for d4yb4c_.
(The format of our PDB-style files is described here.)

Timeline for d4yb4c_: