SCOPe 2.08: Domain d4yb4c_: 4yb4 C:

Lineage for d4yb4c_ (4yb4 C:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.77: Isocitrate/Isopropylmalate dehydrogenase-like [53658] (1 superfamily)
   consists of two intertwined (sub)domains related by pseudo dyad; duplication
   3 layers: a/b/a; single mixed beta-sheet of 10 strands, order 213A945867 (A=10); strands from 5 to 9 are antiparallel to the rest

4. Superfamily c.77.1: Isocitrate/Isopropylmalate dehydrogenase-like [53659] (6 families)
   the constituent families form similar dimers

5. Family c.77.1.0: automated matches [191423] (1 protein)
   not a true family

6. Protein automated matches [190603] (25 species)
   not a true protein

7. Species Thermus thermophilus [TaxId:262724] [189625] (2 PDB entries)

8. Domain d4yb4c_: 4yb4 C: [311927]
   automated match to d1x0la_
   complexed with 48y, gol, mg, nai, so4

Details for d4yb4c_

PDB Entry: 4yb4, 2.5 Å

PDB Description: crystal structure of homoisocitrate dehydrogenase from thermus thermophilus in complex with homoisocitrate, magnesium ion (ii) and nadh

PDB Compounds: (C:) Homoisocitrate dehydrogenase

SCOPe Domain Sequences for d4yb4c_:

Sequence; same for both SEQRES and ATOM records:

>d4yb4c_ c.77.1.0 (C:) automated matches {Thermus thermophilus [TaxId: 262724]}
ayricliegdgighevipaarrvleatglplefveaeagwetferrgtsvpeetvekils
chatlfgaatsptrkvpgffgairylrrrldlyanvrpaksrpvpgsrpgvdlvivrent
eglyveqerryldvaiadaviskkaserigraalriaegrprktlhiahkanvlpltqgl
fldtvkevakdfplvnvqdiivdncamqlvmrperfdvivttnllgdilsdlaaglvggl
glapsgnigdttavfepvhgsapdiagkgianptaailsaammldylgekeaakrvekav
dlvlergprtpdlggdatteafteavvealksl

Timeline for d4yb4c_:

• d4yb4c_ first appeared in SCOPe 2.06
  
• d4yb4c_ appears in SCOPe 2.07