| Class b: All beta proteins [48724] (180 folds) |
| Fold b.25: Osmotin, thaumatin-like protein [49869] (1 superfamily) sandwich; 11 strands in 2 sheets |
Superfamily b.25.1: Osmotin, thaumatin-like protein [49870] (2 families) ![]() has two smaller insertion domains |
| Family b.25.1.1: Osmotin, thaumatin-like protein [49871] (5 proteins) automatically mapped to Pfam PF00314 |
| Protein Thaumatin [49876] (1 species) |
| Species Ketemfe (Thaumatococcus daniellii) [TaxId:4621] [49877] (117 PDB entries) Uniprot P02883 |
| Domain d4xvba_: 4xvb A: [311926] automated match to d1thva_ complexed with tla |
PDB Entry: 4xvb (more details), 1.52 Å
SCOPe Domain Sequences for d4xvba_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4xvba_ b.25.1.1 (A:) Thaumatin {Ketemfe (Thaumatococcus daniellii) [TaxId: 4621]}
atfeivnrcsytvwaaaskgdaaldaggrqlnsgeswtinvepgtnggkiwartdcyfdd
sgsgicktgdcggllrckrfgrppttlaefslnqygkdyidisnikgfnvpmdfspttrg
crgvrcaadivgqcpaklkapgggcndactvfqtseyccttgkcgpteysrffkrlcpda
fsyvldkpttvtcpgssnyrvtfcpta
Timeline for d4xvba_: