SCOPe 2.06: Domain d4yb6f2: 4yb6 F:225-299

Lineage for d4yb6f2 (4yb6 F:225-299)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.5: GlnB-like [54913] (6 families)
   form timeric structures with the orthogonally packed beta-sheets

5. Family d.58.5.0: automated matches [191474] (1 protein)
   not a true family

6. Protein automated matches [190753] (16 species)
   not a true protein

7. Species Campylobacter jejuni [TaxId:195099] [311910] (3 PDB entries)

8. Domain d4yb6f2: 4yb6 F:225-299 [311916]
   Other proteins in same PDB: d4yb6a1, d4yb6b1, d4yb6c1, d4yb6d1, d4yb6e1, d4yb6f1
   automated match to d1h3da2
   complexed with amp, his, mg, peg

Details for d4yb6f2

PDB Entry: 4yb6, 1.98 Å

PDB Description: adenosine triphosphate phosphoribosyltransferase from campylobacter jejuni in complex with the inhibitors amp and histidine

PDB Compounds: (F:) ATP phosphoribosyltransferase

SCOPe Domain Sequences for d4yb6f2:

Sequence; same for both SEQRES and ATOM records:

>d4yb6f2 d.58.5.0 (F:225-299) automated matches {Campylobacter jejuni [TaxId: 195099]}
eskyimlhapkekldkiqallpgverptilplahdeknvalhmvskenlfwetmealkee
gassilvlpiekmlk

Timeline for d4yb6f2:

• d4yb6f2 is new in SCOPe 2.06-stable
  
• d4yb6f2 appears in SCOPe 2.07
  
• d4yb6f2 appears in the current release, SCOPe 2.08