SCOPe 2.07: Domain d4yb7h1: 4yb7 H:4-224

Lineage for d4yb7h1 (4yb7 H:4-224)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
   consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
   mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest

4. Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families)
   Similar in architecture to the superfamily I but partly differs in topology

5. Family c.94.1.0: automated matches [191309] (1 protein)
   not a true family

6. Protein automated matches [190039] (158 species)
   not a true protein

7. Species Campylobacter jejuni [TaxId:195099] [311908] (7 PDB entries)

8. Domain d4yb7h1: 4yb7 H:4-224 [311909]
   Other proteins in same PDB: d4yb7a2, d4yb7b2, d4yb7c2, d4yb7d2, d4yb7e2, d4yb7f2, d4yb7g2, d4yb7h2, d4yb7i2, d4yb7j2, d4yb7k2, d4yb7l2
   automated match to d1h3da1
   complexed with acy, atp, mg, po4

Details for d4yb7h1

PDB Entry: 4yb7, 2.2 Å

PDB Description: adenosine triphosphate phosphoribosyltransferase from campylobacter jejuni in complex with atp

PDB Compounds: (H:) ATP phosphoribosyltransferase

SCOPe Domain Sequences for d4yb7h1:

Sequence; same for both SEQRES and ATOM records:

>d4yb7h1 c.94.1.0 (H:4-224) automated matches {Campylobacter jejuni [TaxId: 195099]}
ntrlriaiqksgrlskesiellsecgvkmhiheqsliafstnlpidilrvrdddipglif
dgvvdlgiigenvleenelerqslgenpsykllkkldfgycrlslalpqenkfqnlkdfe
glriatsypqllkrfmkenginyknctltgsvevapranladaicdlvssgatlqannlk
evkviyesracliqkenalskekqalvdkimlrvagvmqar

Timeline for d4yb7h1:

• d4yb7h1 first appeared in SCOPe 2.06
  
• d4yb7h1 appears in the current release, SCOPe 2.08