| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily) consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest |
Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) ![]() Similar in architecture to the superfamily I but partly differs in topology |
| Family c.94.1.0: automated matches [191309] (1 protein) not a true family |
| Protein automated matches [190039] (140 species) not a true protein |
| Species Campylobacter jejuni [TaxId:195099] [311908] (7 PDB entries) |
| Domain d4yb7h1: 4yb7 H:4-224 [311909] Other proteins in same PDB: d4yb7a2, d4yb7b2, d4yb7c2, d4yb7d2, d4yb7e2, d4yb7f2, d4yb7g2, d4yb7h2, d4yb7i2, d4yb7j2, d4yb7k2, d4yb7l2 automated match to d1h3da1 complexed with acy, atp, mg, po4 |
PDB Entry: 4yb7 (more details), 2.2 Å
SCOPe Domain Sequences for d4yb7h1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4yb7h1 c.94.1.0 (H:4-224) automated matches {Campylobacter jejuni [TaxId: 195099]}
ntrlriaiqksgrlskesiellsecgvkmhiheqsliafstnlpidilrvrdddipglif
dgvvdlgiigenvleenelerqslgenpsykllkkldfgycrlslalpqenkfqnlkdfe
glriatsypqllkrfmkenginyknctltgsvevapranladaicdlvssgatlqannlk
evkviyesracliqkenalskekqalvdkimlrvagvmqar
Timeline for d4yb7h1: