Lineage for d1czua_ (1czu A:)

  1. Root: SCOPe 2.08
  2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. Superfamily c.23.5: Flavoproteins [52218] (9 families) (S)
  5. Family c.23.5.1: Flavodoxin-related [52219] (6 proteins)
    binds FMN
  6. Protein Flavodoxin [52220] (11 species)
  7. Species Synechococcus elongatus PCC 7942 [TaxId:1140] [52225] (10 PDB entries)
  8. Domain d1czua_: 1czu A: [31190]
    complexed with fmn

Details for d1czua_

PDB Entry: 1czu (more details), 2 Å

PDB Description: refined structures of oxidized flavodoxin from anacystis nidulans
PDB Compounds: (A:) flavodoxin

SCOPe Domain Sequences for d1czua_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1czua_ c.23.5.1 (A:) Flavodoxin {Synechococcus elongatus PCC 7942 [TaxId: 1140]}
akiglfygtqtgvtqtiaesiqqefggesivdlndianadasdlnaydyliigcptwnvg
elqsdwegiyddldsvnfqgkkvayfgagdqvgysdnfqdamgileekisslgsqtvgyw
piegydfneskavrnnqfvglaidednqpdltknriktwvsqlksefgl

SCOPe Domain Coordinates for d1czua_ are not available.

Timeline for d1czua_: