Lineage for d1czua_ (1czu A:)
- Root: SCOPe 2.08
Class c: Alpha and beta proteins (a/b) [51349] (148 folds) 
Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
Superfamily c.23.5: Flavoproteins [52218] (9 families) 
Family c.23.5.1: Flavodoxin-related [52219] (6 proteins)
binds FMN
Protein Flavodoxin [52220] (11 species) 
Species Synechococcus elongatus PCC 7942 [TaxId:1140] [52225] (10 PDB entries) 
Domain d1czua_: 1czu A: [31190]
complexed with fmn
Details for d1czua_
PDB Entry: 1czu (more details), 2 Å
PDB Description: refined structures of oxidized flavodoxin from anacystis nidulans
PDB Compounds: (A:) flavodoxinSCOPe Domain Sequences for d1czua_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1czua_ c.23.5.1 (A:) Flavodoxin {Synechococcus elongatus PCC 7942 [TaxId: 1140]}
akiglfygtqtgvtqtiaesiqqefggesivdlndianadasdlnaydyliigcptwnvg
elqsdwegiyddldsvnfqgkkvayfgagdqvgysdnfqdamgileekisslgsqtvgyw
piegydfneskavrnnqfvglaidednqpdltknriktwvsqlksefgl
SCOPe Domain Coordinates for d1czua_:
Click to download the PDB-style file with coordinates for d1czua_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1czua_:
- d1czua_ first appeared (with stable ids) in SCOP 1.55
- d1czua_ appears in SCOPe 2.07
View in 3D