Lineage for d4xtma_ (4xtm A:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2387948Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 2387949Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families) (S)
  5. 2390272Family b.29.1.0: automated matches [191363] (1 protein)
    not a true family
  6. 2390273Protein automated matches [190437] (66 species)
    not a true protein
  7. 2391066Species Vatairea macrocarpa [TaxId:77050] [268912] (6 PDB entries)
  8. 2391076Domain d4xtma_: 4xtm A: [311898]
    automated match to d3n35a_
    complexed with a2g, ca, cit, gol, mn, so4

Details for d4xtma_

PDB Entry: 4xtm (more details), 2.7 Å

PDB Description: crystal structure of a recombinant vatairea macrocarpa seed lectin complexed with galnac
PDB Compounds: (A:) seed lectin

SCOPe Domain Sequences for d4xtma_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4xtma_ b.29.1.0 (A:) automated matches {Vatairea macrocarpa [TaxId: 77050]}
sevvsfsftkfnpnpkdiilqgdalvtskgklqltkvkdgkpvdhslgralyaapihiwd
dstdrvasfatsfsfvveapdesktadgiafflappdtqpqkdggflglfndsnksiqtv
avefdtfsntwdpsarhiginvnsiesmkyvkwgwengkvanvyisyeastktltaslty
psnatsyivsanvdlksalpewvrvgfsatsglsrdhvethdvldwsftstlq

SCOPe Domain Coordinates for d4xtma_:

Click to download the PDB-style file with coordinates for d4xtma_.
(The format of our PDB-style files is described here.)

Timeline for d4xtma_: