Lineage for d4y4la_ (4y4l A:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2457625Fold c.3: FAD/NAD(P)-binding domain [51904] (1 superfamily)
    core: 3 layers, b/b/a; central parallel beta-sheet of 5 strands, order 32145; top antiparallel beta-sheet of 3 strands, meander
  4. 2457626Superfamily c.3.1: FAD/NAD(P)-binding domain [51905] (9 families) (S)
  5. 2458540Family c.3.1.6: Thi4-like [141942] (2 proteins)
    Pfam PF01946; stand-alone, moderately decorated domain
  6. 2458541Protein Thiazole biosynthetic enzyme Thi4 [141943] (2 species)
  7. 2458542Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [141944] (2 PDB entries)
    Uniprot P32318 16-326
    mitochondrial
  8. 2458545Domain d4y4la_: 4y4l A: [311896]
    automated match to d2gjcb_
    complexed with 48n

Details for d4y4la_

PDB Entry: 4y4l (more details), 2 Å

PDB Description: crystal structure of yeast thi4-c205s
PDB Compounds: (A:) Thiamine thiazole synthase

SCOPe Domain Sequences for d4y4la_:

Sequence, based on SEQRES records: (download)

>d4y4la_ c.3.1.6 (A:) Thiazole biosynthetic enzyme Thi4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
vthclsdivkkedwsdfkfapirestvsramtsryfkdldkfavsdviivgagssglsaa
yviaknrpdlkvciiessvapgggswlggqlfsamvmrkpahlflqeleipyedegdyvv
vkhaalfistvlskvlqlpnvklfnatcvedlvtrpptekgevtvagvvtnwtlvtqahg
tqcsmdpnvielagykndgtrdlsqkhgvilsttghdgpfgafcakrivdidqnqklggm
kgldmnhaehdvvihsgayagvdnmyfagmevaeldglnrmgptfgamalsgvhaaeqil
khfa

Sequence, based on observed residues (ATOM records): (download)

>d4y4la_ c.3.1.6 (A:) Thiazole biosynthetic enzyme Thi4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
vthclsdivkkedwsdfkfapirestvsramtsryfkdldkfavsdviivgagssglsaa
yviaknrpdlkvciiessvapgggswlggqlfsamvmrkpahlflqeleipyedegdyvv
vkhaalfistvlskvlqlpnvklfnatcvedlvtrpptekgevtvagvvtnwtlvtqahg
tcsmdpnvielagykndgtrdlsqkhgvilsttghdgpfgafcakrivdidqnqklggmk
gldmnhaehdvvihsgayagvdnmyfagmevaeldglnrmgptfgamalsgvhaaeqilk
hfa

SCOPe Domain Coordinates for d4y4la_:

Click to download the PDB-style file with coordinates for d4y4la_.
(The format of our PDB-style files is described here.)

Timeline for d4y4la_: